Lineage for d6d0lb_ (6d0l B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. Protein automated matches [191036] (17 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries)
  8. Domain d6d0lb_: 6d0l B: [353209]
    automated match to d3kvha_

Details for d6d0lb_

PDB Entry: 6d0l (more details), 1.97 Å

PDB Description: structure of human tirr
PDB Compounds: (B:) Tudor-interacting repair regulator protein

SCOPe Domain Sequences for d6d0lb_:

Sequence, based on SEQRES records: (download)

>d6d0lb_ d.113.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvd
rrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhaveis
avhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpeekl
vealaaatekqkkalekllp

Sequence, based on observed residues (ATOM records): (download)

>d6d0lb_ d.113.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvd
rrfwsledglnrvlglglrlteadylsshltehrvvahlyarqltleqlhaveisavhsr
dhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpeeklveala
aatekqkkalekllp

SCOPe Domain Coordinates for d6d0lb_ are not available.

Timeline for d6d0lb_:

Domains from other chains:
(mouse over for more information)
d6d0la_