Lineage for d6cqna2 (6cqn A:82-181)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349920Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 3053125Species Homo sapiens [TaxId:9606] [353187] (1 PDB entry)
  8. 3053126Domain d6cqna2: 6cqn A:82-181 [353188]
    Other proteins in same PDB: d6cqna1, d6cqnb1, d6cqnb2, d6cqnd1, d6cqnd2, d6cqne1, d6cqne2
    automated match to d1ieaa1
    complexed with cl, mg, nag, so4

Details for d6cqna2

PDB Entry: 6cqn (more details), 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d6cqna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqna2 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Homo sapiens [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d6cqna2:

Click to download the PDB-style file with coordinates for d6cqna2.
(The format of our PDB-style files is described here.)

Timeline for d6cqna2:

  • d6cqna2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-07