Lineage for d6ex9a_ (6ex9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886120Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)
  8. 2886209Domain d6ex9a_: 6ex9 A: [353186]
    automated match to d1exqa_

Details for d6ex9a_

PDB Entry: 6ex9 (more details), 2.01 Å

PDB Description: crystal structure of hiv-1 integrase catalytic core domain with inhibitor peptide
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6ex9a_:

Sequence, based on SEQRES records: (download)

>d6ex9a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
ngsnftgatvraacdwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d6ex9a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
ngsnftgatvraacdwagikqefqgvvesmnkelkkiigqvrdqaehlktavqmavfihn
kkrkgysagerivdiiatdi

SCOPe Domain Coordinates for d6ex9a_:

Click to download the PDB-style file with coordinates for d6ex9a_.
(The format of our PDB-style files is described here.)

Timeline for d6ex9a_: