Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6cqna1: 6cqn A:5-81 [353184] Other proteins in same PDB: d6cqna2, d6cqna3, d6cqnb1, d6cqnb2, d6cqnd1, d6cqnd2, d6cqne1, d6cqne2 automated match to d1fnga2 complexed with cl, mg, nag, so4 |
PDB Entry: 6cqn (more details), 2.5 Å
SCOPe Domain Sequences for d6cqna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cqna1 d.19.1.0 (A:5-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} hviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalania vdkanleimtkrsnytp
Timeline for d6cqna1: