Lineage for d6cqna1 (6cqn A:4-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 3053122Domain d6cqna1: 6cqn A:4-81 [353184]
    Other proteins in same PDB: d6cqna2, d6cqnb1, d6cqnb2, d6cqnd1, d6cqnd2, d6cqne1, d6cqne2
    automated match to d1fnga2
    complexed with cl, mg, nag, so4

Details for d6cqna1

PDB Entry: 6cqn (more details), 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d6cqna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqna1 d.19.1.0 (A:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d6cqna1:

Click to download the PDB-style file with coordinates for d6cqna1.
(The format of our PDB-style files is described here.)

Timeline for d6cqna1:

  • d6cqna1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-06