Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.0: automated matches [191395] (1 protein) not a true family |
Protein automated matches [190512] (7 species) not a true protein |
Species Elizabethkingia anophelis [TaxId:1338011] [353181] (1 PDB entry) |
Domain d6d9na_: 6d9n A: [353182] Other proteins in same PDB: d6d9nb2 automated match to d1n2fa_ complexed with edo, scn |
PDB Entry: 6d9n (more details), 1.2 Å
SCOPe Domain Sequences for d6d9na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d9na_ d.227.1.0 (A:) automated matches {Elizabethkingia anophelis [TaxId: 1338011]} mktlytigatatggrnghvksdngvlefevrypkglgganddyanpemlfaagysacfds alnlviksakiktgettvtakvgigqienggfglevelhanipgvtieeaqdliekahqv cpysnatrgnievkltvsnn
Timeline for d6d9na_: