Lineage for d6d9na_ (6d9n A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007925Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 3007926Protein automated matches [190512] (7 species)
    not a true protein
  7. 3007953Species Elizabethkingia anophelis [TaxId:1338011] [353181] (1 PDB entry)
  8. 3007954Domain d6d9na_: 6d9n A: [353182]
    Other proteins in same PDB: d6d9nb2
    automated match to d1n2fa_
    complexed with edo, scn

Details for d6d9na_

PDB Entry: 6d9n (more details), 1.2 Å

PDB Description: crystal structure of an organic hydroperoxide resistance protein from elizabethkingia anophelis with crystallant-derived thiocyanate bound
PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6d9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d9na_ d.227.1.0 (A:) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
mktlytigatatggrnghvksdngvlefevrypkglgganddyanpemlfaagysacfds
alnlviksakiktgettvtakvgigqienggfglevelhanipgvtieeaqdliekahqv
cpysnatrgnievkltvsnn

SCOPe Domain Coordinates for d6d9na_:

Click to download the PDB-style file with coordinates for d6d9na_.
(The format of our PDB-style files is described here.)

Timeline for d6d9na_: