Lineage for d1e60a2 (1e60 A:4-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908420Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2908421Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (2 families) (S)
    molybdopterine enzyme
  5. 2908422Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2908431Protein Dimethylsulfoxide reductase (DMSO reductase) [53708] (2 species)
  7. 2908432Species Rhodobacter capsulatus [TaxId:1061] [53710] (10 PDB entries)
  8. 2908442Domain d1e60a2: 1e60 A:4-625 [35318]
    Other proteins in same PDB: d1e60a1, d1e60c1
    complexed with 2mo, pgd, so4

Details for d1e60a2

PDB Entry: 1e60 (more details), 2 Å

PDB Description: oxidized dmso reductase exposed to hepes - structure ii buffer
PDB Compounds: (A:) Dimethyl sulfoxide/trimethylamine N-oxide reductase

SCOPe Domain Sequences for d1e60a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e60a2 c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
angtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrre
flekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlh
ncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvf
waadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqtd
vaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaet
ikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgg
gtpstsgpalagitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskfp
dvkmaywvggnpfvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyernd
ietigdysntgilamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyd
daakqgkaagvempafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiy
skniekmgyddcpahptwmepl

SCOPe Domain Coordinates for d1e60a2:

Click to download the PDB-style file with coordinates for d1e60a2.
(The format of our PDB-style files is described here.)

Timeline for d1e60a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e60a1