SCOPe 2.07: Domain d6cqne2: 6cqn E:132-260

Lineage for d6cqne2 (6cqn E:132-260)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6cqne2: 6cqn E:132-260 [353178]
   Other proteins in same PDB: d6cqna1, d6cqna2, d6cqnb1, d6cqnb2, d6cqnd2
   automated match to d1tcrb2
   complexed with cl, mg, nag, so4

Details for d6cqne2

PDB Entry: 6cqn, 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex

PDB Compounds: (E:) F5 beta chain

SCOPe Domain Sequences for d6cqne2:

Sequence; same for both SEQRES and ATOM records:

>d6cqne2 b.1.1.0 (E:132-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6cqne2:

• d6cqne2 is new in SCOPe 2.07-stable
  
• d6cqne2 appears in the current release, SCOPe 2.08