Lineage for d6co1a_ (6co1 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2578347Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2578348Protein automated matches [191036] (17 species)
    not a true protein
  7. 2578438Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries)
  8. 2578476Domain d6co1a_: 6co1 A: [353173]
    Other proteins in same PDB: d6co1e1, d6co1e2, d6co1f1, d6co1f2
    automated match to d3kvha_
    protein/DNA complex

Details for d6co1a_

PDB Entry: 6co1 (more details), 2.18 Å

PDB Description: structure of human tirr in complex with 53bp1 tudor domains
PDB Compounds: (A:) Tudor-interacting repair regulator protein

SCOPe Domain Sequences for d6co1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6co1a_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpelkqisrveamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpgg
fvdrrfwsledglnrvlglglgclrlteadylsshltegphrvvahlyarqltleqlhav
eisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakcqllfalkvlnmmpe
eklvealaaatekqkkalekl

SCOPe Domain Coordinates for d6co1a_:

Click to download the PDB-style file with coordinates for d6co1a_.
(The format of our PDB-style files is described here.)

Timeline for d6co1a_: