Lineage for d1e61a2 (1e61 A:4-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27580Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
  4. 27581Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
  5. 27582Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (5 proteins)
  6. 27591Protein Dimethylsulfoxide reductase (DMSO reductase) [53708] (2 species)
  7. 27592Species Rhodobacter capsulatus [TaxId:1061] [53710] (9 PDB entries)
  8. 27597Domain d1e61a2: 1e61 A:4-625 [35316]
    Other proteins in same PDB: d1e61a1, d1e61c1

Details for d1e61a2

PDB Entry: 1e61 (more details), 1.9 Å

PDB Description: oxidized dmso reductase exposed to hepes - structure ii buffer

SCOP Domain Sequences for d1e61a2:

Sequence, based on SEQRES records: (download)

>d1e61a2 c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
angtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrre
flekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlh
ncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvf
waadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqtd
vaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaet
ikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgg
gtpstsgpalagitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskfp
dvkmaywvggnpfvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyernd
ietigdysntgilamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyd
daakqgkaagvempafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiy
skniekmgyddcpahptwmepl

Sequence, based on observed residues (ATOM records): (download)

>d1e61a2 c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
angtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrre
flekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlh
ncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvf
waadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqtd
vaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaet
ikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgg
gtpstsgpalagitdgggasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnp
fvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgi
lamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagve
mpafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddc
pahptwmepl

SCOP Domain Coordinates for d1e61a2:

Click to download the PDB-style file with coordinates for d1e61a2.
(The format of our PDB-style files is described here.)

Timeline for d1e61a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e61a1