Lineage for d1e18a2 (1e18 A:3-625)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140544Protein Dimethylsulfoxide reductase (DMSO reductase) [53708] (2 species)
  7. 2140545Species Rhodobacter capsulatus [TaxId:1061] [53710] (10 PDB entries)
  8. 2140549Domain d1e18a2: 1e18 A:3-625 [35315]
    Other proteins in same PDB: d1e18a1
    Tungsten-substituted
    complexed with 6wo, eoh, pgd

Details for d1e18a2

PDB Entry: 1e18 (more details), 2 Å

PDB Description: tungsten-susbstituted dmso reductase from rhodobacter capsulatus
PDB Compounds: (A:) dmso reductase.

SCOPe Domain Sequences for d1e18a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e18a2 c.81.1.1 (A:3-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
langtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrr
eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpqgvfggsygwkspgrl
hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqt
dvaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpae
tikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
ggtpstsgpalagitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskf
pdvkmaywvggnpfvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyern
dietigdysntgilamkkiveplyearsdydifaavaerlgkgkeftegkdemgwiksfy
ddaakqgkaagvempafdafwaegivefpvtdgadfvryasfredpllnplgtptgliei
yskniekmgyddcpahptwmepl

SCOPe Domain Coordinates for d1e18a2:

Click to download the PDB-style file with coordinates for d1e18a2.
(The format of our PDB-style files is described here.)

Timeline for d1e18a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e18a1