SCOPe 2.08: Domain d5zqjb1: 5zqj B:1-323

Lineage for d5zqjb1 (5zqj B:1-323)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.0: automated matches [227228] (1 protein)
   not a true family

6. Protein automated matches [226971] (7 species)
   not a true protein

7. Species Bacillus pumilus [TaxId:1408] [353054] (4 PDB entries)

8. Domain d5zqjb1: 5zqj B:1-323 [353148]
   Other proteins in same PDB: d5zqja2, d5zqjb2
   automated match to d3c2ua1
   complexed with gol

Details for d5zqjb1

PDB Entry: 5zqj, 1.73 Å

PDB Description: crystal structure of beta-xylosidase from bacillus pumilus

PDB Compounds: (B:) beta-xylosidase

SCOPe Domain Sequences for d5zqjb1:

Sequence; same for both SEQRES and ATOM records:

>d5zqjb1 b.67.2.0 (B:1-323) automated matches {Bacillus pumilus [TaxId: 1408]}
mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
piklteaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
pyvvggkeglleveapamsvkef

Timeline for d5zqjb1:

• d5zqjb1 first appeared in SCOPe 2.07