Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
Domain d6cvmd4: 6cvm D:626-730 [353146] Other proteins in same PDB: d6cvma1, d6cvma3, d6cvma5, d6cvmb1, d6cvmb3, d6cvmb5, d6cvmc1, d6cvmc3, d6cvmc5, d6cvmd1, d6cvmd3, d6cvmd5 automated match to d1jz8a2 complexed with mg, na, ptq |
PDB Entry: 6cvm (more details), 1.9 Å
SCOPe Domain Sequences for d6cvmd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cvmd4 b.1.4.0 (D:626-730) automated matches {Escherichia coli [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d6cvmd4:
View in 3D Domains from same chain: (mouse over for more information) d6cvmd1, d6cvmd2, d6cvmd3, d6cvmd5 |