Lineage for d1dms_2 (1dms 3-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27580Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
  4. 27581Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
  5. 27582Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (5 proteins)
  6. 27591Protein Dimethylsulfoxide reductase (DMSO reductase) [53708] (2 species)
  7. 27592Species Rhodobacter capsulatus [TaxId:1061] [53710] (9 PDB entries)
  8. 27594Domain d1dms_2: 1dms 3-625 [35314]
    Other proteins in same PDB: d1dms_1

Details for d1dms_2

PDB Entry: 1dms (more details), 1.88 Å

PDB Description: structure of dmso reductase

SCOP Domain Sequences for d1dms_2:

Sequence, based on SEQRES records: (download)

>d1dms_2 c.81.1.1 (3-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
langtvmsgshwgvftatvengrataftpwekdphptpmlegvldsiysptrikypmvrr
eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpqgvfggsygwkspgrl
hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgadhvtpkpqt
dvaimlgmahtlvaedlydkdfianytsgfdkflpylmgetdstpktaewasdisgvpae
tikelarlfkskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
ggtpsssgpalsgitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskf
pdvkmaywvggnpfvhhqdrnrmvkawekletfivhdfqwtptarhadivlpattsyern
dietigdysntgilamkkiveplyearsdydifaavaerlgkgkeftegkdemgwiksfy
ddaakqgkaggvempafdafwaegivefpvtdgadfvryasfredpllnplgtptgliei
yskniekmgyddcpahptwmepl

Sequence, based on observed residues (ATOM records): (download)

>d1dms_2 c.81.1.1 (3-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
langtvmsgshwgvftatvengrataftpwekdphptpmlegvldsiysptrikypmvrr
eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpqgvfggsygwkspgrl
hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgadhvtpkpqt
dvaimlgmahtlvaedlydkdfianytsgfdkflpylmgetdstpktaewasdisgvpae
tikelarlfkskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
ggtpsssgpalsgitdggasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnp
fvhhqdrnrmvkawekletfivhdfqwtptarhadivlpattsyerndietigdysntgi
lamkkiveplyearsdydifaavaerlgkgkeftegkdemgwiksfyddaakqgkaggve
mpafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddc
pahptwmepl

SCOP Domain Coordinates for d1dms_2:

Click to download the PDB-style file with coordinates for d1dms_2.
(The format of our PDB-style files is described here.)

Timeline for d1dms_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dms_1