Lineage for d1dmsa2 (1dms A:3-625)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140544Protein Dimethylsulfoxide reductase (DMSO reductase) [53708] (2 species)
  7. 2140545Species Rhodobacter capsulatus [TaxId:1061] [53710] (10 PDB entries)
  8. 2140548Domain d1dmsa2: 1dms A:3-625 [35314]
    Other proteins in same PDB: d1dmsa1
    complexed with mm4, pgd

Details for d1dmsa2

PDB Entry: 1dms (more details), 1.88 Å

PDB Description: structure of dmso reductase
PDB Compounds: (A:) dmso reductase

SCOPe Domain Sequences for d1dmsa2:

Sequence, based on SEQRES records: (download)

>d1dmsa2 c.81.1.1 (A:3-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
langtvmsgshwgvftatvengrataftpwekdphptpmlegvldsiysptrikypmvrr
eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpqgvfggsygwkspgrl
hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgadhvtpkpqt
dvaimlgmahtlvaedlydkdfianytsgfdkflpylmgetdstpktaewasdisgvpae
tikelarlfkskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
ggtpsssgpalsgitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskf
pdvkmaywvggnpfvhhqdrnrmvkawekletfivhdfqwtptarhadivlpattsyern
dietigdysntgilamkkiveplyearsdydifaavaerlgkgkeftegkdemgwiksfy
ddaakqgkaggvempafdafwaegivefpvtdgadfvryasfredpllnplgtptgliei
yskniekmgyddcpahptwmepl

Sequence, based on observed residues (ATOM records): (download)

>d1dmsa2 c.81.1.1 (A:3-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus [TaxId: 1061]}
langtvmsgshwgvftatvengrataftpwekdphptpmlegvldsiysptrikypmvrr
eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpqgvfggsygwkspgrl
hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgadhvtpkpqt
dvaimlgmahtlvaedlydkdfianytsgfdkflpylmgetdstpktaewasdisgvpae
tikelarlfkskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
ggtpsssgpalsgitdggasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnp
fvhhqdrnrmvkawekletfivhdfqwtptarhadivlpattsyerndietigdysntgi
lamkkiveplyearsdydifaavaerlgkgkeftegkdemgwiksfyddaakqgkaggve
mpafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddc
pahptwmepl

SCOPe Domain Coordinates for d1dmsa2:

Click to download the PDB-style file with coordinates for d1dmsa2.
(The format of our PDB-style files is described here.)

Timeline for d1dmsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dmsa1