SCOPe 2.07: Domain d5nz1f2: 5nz1 F:95-214

Lineage for d5nz1f2 (5nz1 F:95-214)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
   Uniprot P96222 22-215

8. Domain d5nz1f2: 5nz1 F:95-214 [353135]
   Other proteins in same PDB: d5nz1a1, d5nz1b1, d5nz1c1, d5nz1d1, d5nz1e1, d5nz1f1, d5nz1g1, d5nz1h1
   automated match to d5nima2
   complexed with 9en

Details for d5nz1f2

PDB Entry: 5nz1, 2.33 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with sutezolid

PDB Compounds: (F:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nz1f2:

Sequence; same for both SEQRES and ATOM records:

>d5nz1f2 a.121.1.1 (F:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d5nz1f2:

• d5nz1f2 is new in SCOPe 2.07-stable
  
• d5nz1f2 appears in the current release, SCOPe 2.08