Lineage for d5o1rm1 (5o1r M:1-105)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5o1rm1: 5o1r M:1-105 [353132]
    Other proteins in same PDB: d5o1rl2, d5o1rm2
    automated match to d1dn0a1
    complexed with edo

Details for d5o1rm1

PDB Entry: 5o1r (more details), 2.86 Å

PDB Description: human fab 5h2 bound to nhba-c3 from neisseria meningitidis serogroup b
PDB Compounds: (M:) Uncharacterized protein

SCOPe Domain Sequences for d5o1rm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o1rm1 b.1.1.0 (M:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtklei

SCOPe Domain Coordinates for d5o1rm1 are not available.

Timeline for d5o1rm1:

Domains from same chain:
(mouse over for more information)
d5o1rm2
Domains from other chains:
(mouse over for more information)
d5o1rl1, d5o1rl2