SCOPe 2.07: Domain d5zrxb1: 5zrx B:1200-1257

Lineage for d5zrxb1 (5zrx B:1200-1257)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [353082] (2 PDB entries)

8. Domain d5zrxb1: 5zrx B:1200-1257 [353127]
   Other proteins in same PDB: d5zrxa3, d5zrxb3
   automated match to d1b0xa_

Details for d5zrxb1

PDB Entry: 5zrx, 1.5 Å

PDB Description: crystal structure of epha2/ship2 complex

PDB Compounds: (B:) Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2,Ephrin type-A receptor 2

SCOPe Domain Sequences for d5zrxb1:

Sequence; same for both SEQRES and ATOM records:

>d5zrxb1 a.60.1.0 (B:1200-1257) automated matches {Mus musculus [TaxId: 10090]}
mgawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldtlqlsk

Timeline for d5zrxb1:

• d5zrxb1 is new in SCOPe 2.07-stable
  
• d5zrxb1 appears in the current release, SCOPe 2.08