Lineage for d1dmr_2 (1dmr 3-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27580Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
  4. 27581Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
  5. 27582Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (5 proteins)
  6. 27591Protein Dimethylsulfoxide reductase (DMSO reductase) [53708] (2 species)
  7. 27592Species Rhodobacter capsulatus [TaxId:1061] [53710] (9 PDB entries)
  8. 27593Domain d1dmr_2: 1dmr 3-625 [35312]
    Other proteins in same PDB: d1dmr_1

Details for d1dmr_2

PDB Entry: 1dmr (more details), 1.82 Å

PDB Description: oxidized dmso reductase from rhodobacter capsulatus

SCOP Domain Sequences for d1dmr_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmr_2 c.81.1.1 (3-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter capsulatus}
langtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrr
eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrl
hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqt
dvaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpae
tikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
ggtpstsgpalagitdggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskf
pdvkmaywvggnpfvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyern
dietigdysntgilamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfy
ddaakqgkaagvqmpafdafwaegivefpvtdgadfvryasfredpllnplgtptgliei
yskniekmgyddcpahptwmepl

SCOP Domain Coordinates for d1dmr_2:

Click to download the PDB-style file with coordinates for d1dmr_2.
(The format of our PDB-style files is described here.)

Timeline for d1dmr_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dmr_1