Lineage for d5vz6a2 (5vz6 A:430-557)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2464026Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2464027Protein automated matches [190396] (40 species)
    not a true protein
  7. 3053056Species Human immunodeficiency virus type 1 [TaxId:11676] [353118] (4 PDB entries)
  8. 3053057Domain d5vz6a2: 5vz6 A:430-557 [353119]
    Other proteins in same PDB: d5vz6a1, d5vz6a3, d5vz6b_
    automated match to d1bqna1
    complexed with 9tv

Details for d5vz6a2

PDB Entry: 5vz6 (more details), 2.6 Å

PDB Description: hiv reverse transcriptase complexed with (e)-3-(pyrimidin-2-yl)-n-(5- (5,6,7,8-tetrahydronaphthalen-2-yl)-1h-pyrazol-3-yl)acrylamide
PDB Compounds: (A:) HIV Reverse transcriptase

SCOPe Domain Sequences for d5vz6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vz6a2 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

SCOPe Domain Coordinates for d5vz6a2:

Click to download the PDB-style file with coordinates for d5vz6a2.
(The format of our PDB-style files is described here.)

Timeline for d5vz6a2:

  • d5vz6a2 is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d5vz6b_