SCOPe 2.08: Domain d5nrha1: 5nrh A:3-102

Lineage for d5nrha1 (5nrh A:3-102)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [226351] (3 PDB entries)

8. Domain d5nrha1: 5nrh A:3-102 [353109]
   Other proteins in same PDB: d5nrha2, d5nrhb2
   automated match to d4egqb1
   complexed with amp, edo, mg, so4

Details for d5nrha1

PDB Entry: 5nrh, 1.3 Å

PDB Description: crystal structure of burkholderia pseudomallei d-alanine-d-alanine ligase in complex with amp

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5nrha1:

Sequence; same for both SEQRES and ATOM records:

>d5nrha1 c.30.1.0 (A:3-102) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegf
vrafnalhggygengqiqgaldfygirytgsgvlgsalgl

Timeline for d5nrha1:

• d5nrha1 first appeared in SCOPe 2.07