Lineage for d5zqja2 (5zqj A:324-535)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (67 species)
    not a true protein
  7. 2780703Species Bacillus pumilus [TaxId:1408] [353056] (4 PDB entries)
  8. 2780710Domain d5zqja2: 5zqj A:324-535 [353107]
    Other proteins in same PDB: d5zqja1, d5zqjb1
    automated match to d3c2ub2
    complexed with gol

Details for d5zqja2

PDB Entry: 5zqj (more details), 1.73 Å

PDB Description: crystal structure of beta-xylosidase from bacillus pumilus
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5zqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zqja2 b.29.1.0 (A:324-535) automated matches {Bacillus pumilus [TaxId: 1408]}
sptyhivdefkdsslnrhfqtlripftdqigsvtenphhlrlygqesltskftqafvarr
wqsfyfeaetavsffpknfqqaaglvnyyntenwtalqvtyddalgrilelsvcenlafs
qplikkiiipdeipyvylkvtvqretytysysfdqqewekidvplesthlsddfirgggf
ftgafvgmqcqdtsgerlpadfkyfryeette

SCOPe Domain Coordinates for d5zqja2:

Click to download the PDB-style file with coordinates for d5zqja2.
(The format of our PDB-style files is described here.)

Timeline for d5zqja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zqja1