Lineage for d5nz1e2 (5nz1 E:95-214)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2340907Protein Ethr repressor [109978] (2 species)
  7. 2340908Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
    Uniprot P96222 22-215
  8. 2340977Domain d5nz1e2: 5nz1 E:95-214 [353102]
    Other proteins in same PDB: d5nz1a1, d5nz1b1, d5nz1c1, d5nz1d1, d5nz1e1, d5nz1f1, d5nz1g1, d5nz1h1
    automated match to d5nima2
    complexed with 9en

Details for d5nz1e2

PDB Entry: 5nz1 (more details), 2.33 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with sutezolid
PDB Compounds: (E:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nz1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nz1e2 a.121.1.1 (E:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5nz1e2:

Click to download the PDB-style file with coordinates for d5nz1e2.
(The format of our PDB-style files is described here.)

Timeline for d5nz1e2: