Lineage for d5zrza_ (5zrz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2324210Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2324348Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2324349Protein automated matches [190031] (3 species)
    not a true protein
  7. 3053020Species Mus musculus [TaxId:10090] [353082] (2 PDB entries)
  8. 3053026Domain d5zrza_: 5zrz A: [353088]
    Other proteins in same PDB: d5zrzb2
    automated match to d3h8ma_

Details for d5zrza_

PDB Entry: 5zrz (more details), 1.89 Å

PDB Description: crystal structure of epha5/samd5 complex
PDB Compounds: (A:) Ephrin type-A receptor 5

SCOPe Domain Sequences for d5zrza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zrza_ a.60.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
gayrsvgewleaikmgryteifmengyssmdavaqvtledlrrlgvtlvghqkkimsslq
emkvqmvng

SCOPe Domain Coordinates for d5zrza_:

Click to download the PDB-style file with coordinates for d5zrza_.
(The format of our PDB-style files is described here.)

Timeline for d5zrza_:

  • d5zrza_ is new in SCOPe 2.07-stable