Lineage for d5zuta1 (5zut A:1-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583562Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2583595Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries)
  8. 2583614Domain d5zuta1: 5zut A:1-126 [353086]
    automated match to d1plqa1

Details for d5zuta1

PDB Entry: 5zut (more details), 2.82 Å

PDB Description: crystal structure of yeast pcna in complex with n24 peptide
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5zuta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zuta1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

SCOPe Domain Coordinates for d5zuta1:

Click to download the PDB-style file with coordinates for d5zuta1.
(The format of our PDB-style files is described here.)

Timeline for d5zuta1: