Lineage for d5zrxa2 (5zrx A:906-970)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. Protein automated matches [190031] (3 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [353082] (2 PDB entries)
  8. Domain d5zrxa2: 5zrx A:906-970 [353084]
    Other proteins in same PDB: d5zrxa3, d5zrxb3
    automated match to d1b0xa_

Details for d5zrxa2

PDB Entry: 5zrx (more details), 1.5 Å

PDB Description: crystal structure of epha2/ship2 complex
PDB Compounds: (A:) Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2,Ephrin type-A receptor 2

SCOPe Domain Sequences for d5zrxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zrxa2 a.60.1.0 (A:906-970) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pfrtvsewlesikmqqytehfmvagytaiekvvqmsnedikrigvrlpghqkriaysllg
lkdqv

SCOPe Domain Coordinates for d5zrxa2 are not available.

Timeline for d5zrxa2:

Domains from same chain:
(mouse over for more information)
d5zrxa1, d5zrxa3
Domains from other chains:
(mouse over for more information)
d5zrxb1, d5zrxb2, d5zrxb3