Lineage for d5zqsa1 (5zqs A:1-323)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2398164Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2398165Protein automated matches [226971] (7 species)
    not a true protein
  7. 3052992Species Bacillus pumilus [TaxId:1408] [353054] (4 PDB entries)
  8. 3052993Domain d5zqsa1: 5zqs A:1-323 [353055]
    Other proteins in same PDB: d5zqsa2, d5zqsb2
    automated match to d3c2ua1
    complexed with bxp, xyp; mutant

Details for d5zqsa1

PDB Entry: 5zqs (more details), 1.78 Å

PDB Description: crystal structure of beta-xylosidase mutant (e186q/f503y) from bacillus pumilus
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5zqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zqsa1 b.67.2.0 (A:1-323) automated matches {Bacillus pumilus [TaxId: 1408]}
mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
pikltqaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
pyvvggkeglleveapamsvkef

SCOPe Domain Coordinates for d5zqsa1:

Click to download the PDB-style file with coordinates for d5zqsa1.
(The format of our PDB-style files is described here.)

Timeline for d5zqsa1:

  • d5zqsa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5zqsa2