Lineage for d5za0a2 (5za0 A:149-312)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527133Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2527224Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 3052987Species Escherichia coli [TaxId:83333] [353049] (1 PDB entry)
  8. 3052988Domain d5za0a2: 5za0 A:149-312 [353050]
    Other proteins in same PDB: d5za0a1
    automated match to d1s7ca2
    complexed with so4, tre

Details for d5za0a2

PDB Entry: 5za0 (more details), 2 Å

PDB Description: a cryo-protectant induces the conformational change of glyceraldehyde- 3-phosphate dehydrogenase
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase a

SCOPe Domain Sequences for d5za0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5za0a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 83333]}
scttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipss
tgaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegem
kgvlgyteddvvstdfngevctsvfdakagialndnfvklvswy

SCOPe Domain Coordinates for d5za0a2:

Click to download the PDB-style file with coordinates for d5za0a2.
(The format of our PDB-style files is described here.)

Timeline for d5za0a2:

  • d5za0a2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-31

View in 3D
Domains from same chain:
(mouse over for more information)
d5za0a1