Lineage for d5za0a1 (5za0 A:2-148,A:313-331)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2428331Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2428572Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 3052985Species Escherichia coli [TaxId:83333] [353047] (1 PDB entry)
  8. 3052986Domain d5za0a1: 5za0 A:2-148,A:313-331 [353048]
    Other proteins in same PDB: d5za0a2
    automated match to d1s7ca1
    complexed with so4, tre

Details for d5za0a1

PDB Entry: 5za0 (more details), 2 Å

PDB Description: a cryo-protectant induces the conformational change of glyceraldehyde- 3-phosphate dehydrogenase
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase a

SCOPe Domain Sequences for d5za0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5za0a1 c.2.1.3 (A:2-148,A:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 83333]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk

SCOPe Domain Coordinates for d5za0a1:

Click to download the PDB-style file with coordinates for d5za0a1.
(The format of our PDB-style files is described here.)

Timeline for d5za0a1:

  • d5za0a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-31

View in 3D
Domains from same chain:
(mouse over for more information)
d5za0a2