Lineage for d5o1rl2 (5o1r L:106-211)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1239 PDB entries)
  8. Domain d5o1rl2: 5o1r L:106-211 [353046]
    Other proteins in same PDB: d5o1rl1, d5o1rm1
    automated match to d1dn0a2
    complexed with edo

Details for d5o1rl2

PDB Entry: 5o1r (more details), 2.86 Å

PDB Description: human fab 5h2 bound to nhba-c3 from neisseria meningitidis serogroup b
PDB Compounds: (L:) Uncharacterized protein

SCOPe Domain Sequences for d5o1rl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o1rl2 b.1.1.2 (L:106-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d5o1rl2 are not available.

Timeline for d5o1rl2:

Domains from same chain:
(mouse over for more information)
d5o1rl1
Domains from other chains:
(mouse over for more information)
d5o1rm1, d5o1rm2