Lineage for d5nx9a_ (5nx9 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. Protein automated matches [190621] (30 species)
    not a true protein
  7. Species Homo sapiens [TaxId:63221] [352880] (3 PDB entries)
  8. Domain d5nx9a_: 5nx9 A: [353043]
    automated match to d2j91b_
    complexed with 2sa, amp, cl, fum, gol, peg

Details for d5nx9a_

PDB Entry: 5nx9 (more details), 2.3 Å

PDB Description: crystal structure of neanderthal adenylosuccinate lyase (adsl) in complex with its products amp and fumarate
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d5nx9a_:

Sequence, based on SEQRES records: (download)

>d5nx9a_ a.127.1.0 (A:) automated matches {Homo sapiens [TaxId: 63221]}
spdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemksn
lenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrnal
dlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlkr
vrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkvd
ievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserccsla
rhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkv
ierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriq
adayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvka

Sequence, based on observed residues (ATOM records): (download)

>d5nx9a_ a.127.1.0 (A:) automated matches {Homo sapiens [TaxId: 63221]}
spdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqemksn
lenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliilrnal
dlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnlkr
vrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrkvd
ievlsvlaslgasvhkictdirllanlkemeepfekqqigkrnpmrserccslarhlmtl
vmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierrir
qelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqadayfs
pihsqldhlldpssftgrasqqvqrfleeevypllkpyesvmkvka

SCOPe Domain Coordinates for d5nx9a_ are not available.

Timeline for d5nx9a_:

Domains from other chains:
(mouse over for more information)
d5nx9b_, d5nx9c_, d5nx9d_