Lineage for d6ejma1 (6ejm A:113-202)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733582Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)
  8. 2733601Domain d6ejma1: 6ejm A:113-202 [353037]
    Other proteins in same PDB: d6ejma2, d6ejmb2, d6ejmh1, d6ejmh2, d6ejmi1, d6ejmi2
    automated match to d3x0ga_

Details for d6ejma1

PDB Entry: 6ejm (more details), 2.15 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 5
PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d6ejma1:

Sequence, based on SEQRES records: (download)

>d6ejma1 a.135.1.1 (A:113-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgkl

Sequence, based on observed residues (ATOM records): (download)

>d6ejma1 a.135.1.1 (A:113-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdannakavvktfhetldccgsstltalttsvlknnl
cpsgsniisnlfkedchqkiddlfsgkl

SCOPe Domain Coordinates for d6ejma1:

Click to download the PDB-style file with coordinates for d6ejma1.
(The format of our PDB-style files is described here.)

Timeline for d6ejma1: