Lineage for d1mora_ (1mor A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140245Family c.80.1.1: double-SIS domain [53698] (5 protein domains)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2140246Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)
  7. 2140247Species Escherichia coli [TaxId:562] [53700] (6 PDB entries)
  8. 2140249Domain d1mora_: 1mor A: [35303]
    complexed with g6p

Details for d1mora_

PDB Entry: 1mor (more details), 1.9 Å

PDB Description: isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate
PDB Compounds: (A:) glucosamine 6-phosphate synthase

SCOPe Domain Sequences for d1mora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mora_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
gdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilacgt
synsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrls
kelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvaklsrl
kgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypialeg
alklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarggq
lyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnla
ksvtve

SCOPe Domain Coordinates for d1mora_:

Click to download the PDB-style file with coordinates for d1mora_.
(The format of our PDB-style files is described here.)

Timeline for d1mora_: