SCOPe 2.07: Domain d5nz1c1: 5nz1 C:22-92

Lineage for d5nz1c1 (5nz1 C:22-92)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
Protein Ethr repressor [109651] (2 species)
Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
Uniprot P96222 22-215
Domain d5nz1c1: 5nz1 C:22-92 [353025]
Other proteins in same PDB: d5nz1a2, d5nz1b2, d5nz1c2, d5nz1d2, d5nz1e2, d5nz1f2, d5nz1g2, d5nz1h2
automated match to d5nima1
complexed with 9en

Details for d5nz1c1

PDB Entry: 5nz1 (more details), 2.33 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with sutezolid

PDB Compounds: (C:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nz1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nz1c1 a.4.1.9 (C:22-92) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlae

SCOPe Domain Coordinates for d5nz1c1:

Click to download the PDB-style file with coordinates for d5nz1c1.
(The format of our PDB-style files is described here.)

Timeline for d5nz1c1: