Lineage for d6ek2b_ (6ek2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733582Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)
  8. 2733611Domain d6ek2b_: 6ek2 B: [353018]
    Other proteins in same PDB: d6ek2a2, d6ek2h1, d6ek2h2, d6ek2i1, d6ek2i2
    automated match to d1g8qa_

Details for d6ek2b_

PDB Entry: 6ek2 (more details), 2.65 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 10
PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d6ek2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ek2b_ a.135.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d6ek2b_:

Click to download the PDB-style file with coordinates for d6ek2b_.
(The format of our PDB-style files is described here.)

Timeline for d6ek2b_: