Lineage for d1f2dd_ (1f2d D:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins) 
Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (1 species) Species Yeast (Hansenula saturnus) [TaxId:4906] [53695] (1 PDB entry) 
Domain d1f2dd_: 1f2d D: [35301]
Details for d1f2dd_
PDB Entry: 1f2d (more details), 2 Å
PDB Description: 1-aminocyclopropane-1-carboxylate deaminase
SCOP Domain Sequences for d1f2dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2dd_ c.79.1.1 (D:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus)}
agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivp
divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvyegksm
qglialikedyfkpganvlyvhlggapalsayssffptkta
SCOP Domain Coordinates for d1f2dd_:
Click to download the PDB-style file with coordinates for d1f2dd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f2dd_:
- d1f2dd_ appears in SCOP 1.57
- d1f2dd_ appears in the current release, SCOPe 2.08, called d1f2dd1
View in 3D
