Lineage for d5nyxn1 (5nyx N:1-105)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5nyxn1: 5nyx N:1-105 [353003]
    Other proteins in same PDB: d5nyxl2, d5nyxn2, d5nyxp2
    automated match to d1dn0a1
    complexed with gol, so4

Details for d5nyxn1

PDB Entry: 5nyx (more details), 1.8800000000000001 Å

PDB Description: human fab fragment 5h2 against nhba from neisseria meningitidis
PDB Compounds: (N:) light chain

SCOPe Domain Sequences for d5nyxn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nyxn1 b.1.1.0 (N:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtklei

SCOPe Domain Coordinates for d5nyxn1 are not available.

Timeline for d5nyxn1:

Domains from same chain:
(mouse over for more information)
d5nyxn2
Domains from other chains:
(mouse over for more information)
d5nyxl1, d5nyxl2, d5nyxp1, d5nyxp2