Lineage for d1f2db1 (1f2d B:2-341)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907394Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 2907448Species Yeast (Hansenula saturnus) [TaxId:4906] [53695] (4 PDB entries)
  8. 2907450Domain d1f2db1: 1f2d B:2-341 [35299]
    Other proteins in same PDB: d1f2da2, d1f2db2, d1f2dc2, d1f2dd2
    complexed with plp, so4

Details for d1f2db1

PDB Entry: 1f2d (more details), 2 Å

PDB Description: 1-aminocyclopropane-1-carboxylate deaminase
PDB Compounds: (B:) 1-aminocyclopropane-1-carboxylate deaminase

SCOPe Domain Sequences for d1f2db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2db1 c.79.1.1 (B:2-341) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]}
gvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivpd
ivegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgniel
srimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfade
vinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlri
anntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvyegksmq
glialikedyfkpganvlyvhlggapalsayssffptkta

SCOPe Domain Coordinates for d1f2db1:

Click to download the PDB-style file with coordinates for d1f2db1.
(The format of our PDB-style files is described here.)

Timeline for d1f2db1: