SCOPe 2.08: Domain d6ejgc2: 6ejg C:170-289

Lineage for d6ejgc2 (6ejg C:170-289)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6ejgc2: 6ejg C:170-289 [352988]
   Other proteins in same PDB: d6ejga1, d6ejga2, d6ejgb1, d6ejgb2
   automated match to d1h8sa2

Details for d6ejgc2

PDB Entry: 6ejg, 2.82 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 4

PDB Compounds: (C:) single chain fv fragment

SCOPe Domain Sequences for d6ejgc2:

Sequence; same for both SEQRES and ATOM records:

>d6ejgc2 b.1.1.0 (C:170-289) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqqsgpelvkpgasvkisckasgytfssswmnwvkqrpgkglewigriysgdgdaiy
ngkfkgkatltadkssstaymqlssltsedsavyfcaregktgdlllrswgqgsaltvss

Timeline for d6ejgc2:

• d6ejgc2 first appeared in SCOPe 2.07