Lineage for d5nx3a_ (5nx3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388519Protein Kallikrein 6 [74974] (1 species)
  7. 2388520Species Human (Homo sapiens) [TaxId:9606] [74975] (9 PDB entries)
  8. 3052921Domain d5nx3a_: 5nx3 A: [352983]
    Other proteins in same PDB: d5nx3c_
    automated match to d1gvla_

Details for d5nx3a_

PDB Entry: 5nx3 (more details), 2.3 Å

PDB Description: combinatorial engineering of proteolytically resistant appi variants that selectively inhibit human kallikrein 6 for cancer therapy
PDB Compounds: (A:) Kallikrein-6

SCOPe Domain Sequences for d5nx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nx3a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa

SCOPe Domain Coordinates for d5nx3a_:

Click to download the PDB-style file with coordinates for d5nx3a_.
(The format of our PDB-style files is described here.)

Timeline for d5nx3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nx3c_