Lineage for d5oiza2 (5oiz A:264-631)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013997Species Streptococcus pneumoniae [TaxId:171101] [352954] (2 PDB entries)
  8. 3013998Domain d5oiza2: 5oiz A:264-631 [352980]
    Other proteins in same PDB: d5oiza1, d5oiza3, d5oiza4
    automated match to d1k25a4
    complexed with 1s6

Details for d5oiza2

PDB Entry: 5oiz (more details), 2.7 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae in complex with oxacillin
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oiza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oiza2 e.3.1.1 (A:264-631) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
akaleqvs

SCOPe Domain Coordinates for d5oiza2:

Click to download the PDB-style file with coordinates for d5oiza2.
(The format of our PDB-style files is described here.)

Timeline for d5oiza2: