![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein automated matches [190161] (29 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:171101] [352954] (2 PDB entries) |
![]() | Domain d5oiza2: 5oiz A:264-631 [352980] Other proteins in same PDB: d5oiza1, d5oiza3, d5oiza4 automated match to d1k25a4 complexed with 1s6 |
PDB Entry: 5oiz (more details), 2.7 Å
SCOPe Domain Sequences for d5oiza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oiza2 e.3.1.1 (A:264-631) automated matches {Streptococcus pneumoniae [TaxId: 171101]} tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt akaleqvs
Timeline for d5oiza2: