SCOPe 2.08: Domain d5nx1a_: 5nx1 A:

Lineage for d5nx1a_ (5nx1 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Kallikrein 6 [74974] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74975] (17 PDB entries)

8. Domain d5nx1a_: 5nx1 A: [352978]
   Other proteins in same PDB: d5nx1c_
   automated match to d1gvla_

Details for d5nx1a_

PDB Entry: 5nx1, 1.85 Å

PDB Description: combinatorial engineering of proteolytically resistant appi variants that selectively inhibit human kallikrein 6 for cancer therapy

PDB Compounds: (A:) Kallikrein-6

SCOPe Domain Sequences for d5nx1a_:

Sequence; same for both SEQRES and ATOM records:

>d5nx1a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa

Timeline for d5nx1a_:

• d5nx1a_ first appeared in SCOPe 2.07