Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Rhizobium sp. [TaxId:1125847] [352895] (1 PDB entry) |
Domain d5nqdb_: 5nqd B: [352977] automated match to d4aayb_ complexed with 4mo, edo, f3s, fes, gol, mgd, o, p33, peg, pge, so4; mutant |
PDB Entry: 5nqd (more details), 2.2 Å
SCOPe Domain Sequences for d5nqdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nqdb_ b.33.1.0 (B:) automated matches {Rhizobium sp. [TaxId: 1125847]} aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic phkgaplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv deliygrlsnvl
Timeline for d5nqdb_: