| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
| Domain d6fiib1: 6fii B:1-245 [352966] Other proteins in same PDB: d6fiia2, d6fiib2, d6fiic2, d6fiid2, d6fiie_, d6fiif1, d6fiif2, d6fiif3 automated match to d4drxb1 complexed with acp, ca, dms, gdp, gol, gtp, mes, mg, sg9 |
PDB Entry: 6fii (more details), 2.41 Å
SCOPe Domain Sequences for d6fiib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fiib1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp
Timeline for d6fiib1: