Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) |
Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries) |
Domain d1d6sb_: 1d6s B: [35296] complexed with met, plp; mutant |
PDB Entry: 1d6s (more details), 2.3 Å
SCOP Domain Sequences for d1d6sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6sb_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 602]} skiyednsltightplvrlnrigngrilakvesrnpsfsvacriganmiwdaekrgvlkp gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps sgerylstalfadlftekelqq
Timeline for d1d6sb_: