Lineage for d1d6sb_ (1d6s B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709069Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 709084Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)
  8. 709092Domain d1d6sb_: 1d6s B: [35296]
    complexed with met, plp; mutant

Details for d1d6sb_

PDB Entry: 1d6s (more details), 2.3 Å

PDB Description: crystal structure of the k41a mutant of o-acetylserine sulfhydrylase complexed in external aldimine linkage with methionine
PDB Compounds: (B:) O-acetylserine sulfhydrylase

SCOP Domain Sequences for d1d6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6sb_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 602]}
skiyednsltightplvrlnrigngrilakvesrnpsfsvacriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfadlftekelqq

SCOP Domain Coordinates for d1d6sb_:

Click to download the PDB-style file with coordinates for d1d6sb_.
(The format of our PDB-style files is described here.)

Timeline for d1d6sb_: