Lineage for d5oj1a3 (5oj1 A:632-692)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) (S)
    duplication: consists of 2 subdomains of this fold
  5. Family d.11.1.0: automated matches [352956] (1 protein)
    not a true family
  6. Protein automated matches [352957] (2 species)
    not a true protein
  7. Species Streptococcus pneumoniae [TaxId:171101] [352958] (2 PDB entries)
  8. Domain d5oj1a3: 5oj1 A:632-692 [352959]
    Other proteins in same PDB: d5oj1a1, d5oj1a2
    automated match to d1k25a1
    complexed with 1s6, na

Details for d5oj1a3

PDB Entry: 5oj1 (more details), 2.8499999999999996 Å

PDB Description: penicillin binding protein 2x (pbp2x) from s.pneumoniae in complex with oxacillin and a tetrasaccharide
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oj1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oj1a3 d.11.1.0 (A:632-692) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
qqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlilsd
k

SCOPe Domain Coordinates for d5oj1a3 are not available.

Timeline for d5oj1a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d5oj1a1, d5oj1a2, d5oj1a4