SCOPe 2.07: Domain d5oj1a2: 5oj1 A:264-631

Lineage for d5oj1a2 (5oj1 A:264-631)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [352954] (2 PDB entries)

8. Domain d5oj1a2: 5oj1 A:264-631 [352955]
   Other proteins in same PDB: d5oj1a1, d5oj1a3, d5oj1a4
   automated match to d1k25a4
   complexed with 1s6, na

Details for d5oj1a2

PDB Entry: 5oj1, 2.85 Å

PDB Description: penicillin binding protein 2x (pbp2x) from s.pneumoniae in complex with oxacillin and a tetrasaccharide

PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oj1a2:

Sequence; same for both SEQRES and ATOM records:

>d5oj1a2 e.3.1.1 (A:264-631) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
akaleqvs

Timeline for d5oj1a2:

• d5oj1a2 is new in SCOPe 2.07-stable
  
• d5oj1a2 appears in the current release, SCOPe 2.08