Lineage for d5oj1a2 (5oj1 A:264-631)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Streptococcus pneumoniae [TaxId:171101] [352954] (2 PDB entries)
  8. Domain d5oj1a2: 5oj1 A:264-631 [352955]
    Other proteins in same PDB: d5oj1a1, d5oj1a3, d5oj1a4
    automated match to d1k25a4
    complexed with 1s6, na

Details for d5oj1a2

PDB Entry: 5oj1 (more details), 2.8499999999999996 Å

PDB Description: penicillin binding protein 2x (pbp2x) from s.pneumoniae in complex with oxacillin and a tetrasaccharide
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oj1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oj1a2 e.3.1.1 (A:264-631) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
akaleqvs

SCOPe Domain Coordinates for d5oj1a2 are not available.

Timeline for d5oj1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5oj1a1, d5oj1a3, d5oj1a4