Lineage for d5oj1a1 (5oj1 A:72-263)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. Protein automated matches [226981] (13 species)
    not a true protein
  7. Species Streptococcus pneumoniae [TaxId:171101] [352952] (2 PDB entries)
  8. Domain d5oj1a1: 5oj1 A:72-263 [352953]
    Other proteins in same PDB: d5oj1a2, d5oj1a3, d5oj1a4
    automated match to d1k25a3
    complexed with 1s6, na

Details for d5oj1a1

PDB Entry: 5oj1 (more details), 2.8499999999999996 Å

PDB Description: penicillin binding protein 2x (pbp2x) from s.pneumoniae in complex with oxacillin and a tetrasaccharide
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oj1a1:

Sequence, based on SEQRES records: (download)

>d5oj1a1 d.175.1.0 (A:72-263) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
vpakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyld
meesyvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypng
qfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgnivpgteqv
sqrtmdgkdvyt

Sequence, based on observed residues (ATOM records): (download)

>d5oj1a1 d.175.1.0 (A:72-263) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
vpakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyld
meesyvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypng
qfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiitylgnivpgteqvsqrt
mdgkdvyt

SCOPe Domain Coordinates for d5oj1a1 are not available.

Timeline for d5oj1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5oj1a2, d5oj1a3, d5oj1a4