Lineage for d1d6sa_ (1d6s A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127373Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 127374Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 127375Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 127393Protein O-acetylserine sulfhydrylase (Cystein synthase) [53690] (1 species)
  7. 127394Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)
  8. 127401Domain d1d6sa_: 1d6s A: [35295]

Details for d1d6sa_

PDB Entry: 1d6s (more details), 2.3 Å

PDB Description: crystal structure of the k41a mutant of o-acetylserine sulfhydrylase complexed in external aldimine linkage with methionine

SCOP Domain Sequences for d1d6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6sa_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystein synthase) {Salmonella typhimurium}
skiyednsltightplvrlnrigngrilakvesrnpsfsvacriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfadlftekelqq

SCOP Domain Coordinates for d1d6sa_:

Click to download the PDB-style file with coordinates for d1d6sa_.
(The format of our PDB-style files is described here.)

Timeline for d1d6sa_: