![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein MAP kinase Erk2 [56134] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56135] (74 PDB entries) |
![]() | Domain d6g9ja_: 6g9j A: [352946] automated match to d1erka_ complexed with erk, so4 |
PDB Entry: 6g9j (more details), 1.98 Å
SCOPe Domain Sequences for d6g9ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g9ja_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} gagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqr tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg
Timeline for d6g9ja_: